PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim11g068950.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 662aa    MW: 72913.2 Da    PI: 7.2425
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim11g068950.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-093894261954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Sopim11g068950.0.1 389 FEHflHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVR 426
                         554459******************************88 PP

2BELL115.52.7e-37253324172
                BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         +rqelq+kkakL+s+l+eVd+rY+qy++q+q+++ sFe+ +g+gs+k+Yt+lAl++iS++FrcLkdai++qi
  Sopim11g068950.0.1 253 QRQELQMKKAKLVSMLDEVDQRYRQYHHQMQMIATSFEQTTGIGSSKSYTQLALHTISKQFRCLKDAISGQI 324
                         69*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-49184322IPR006563POX domain
PfamPF075264.5E-45187321IPR006563POX domain
PROSITE profilePS5007112.131367430IPR001356Homeobox domain
SMARTSM003894.2E-10370434IPR001356Homeobox domain
CDDcd000863.38E-12370431No hitNo description
SuperFamilySSF466893.98E-17371437IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-29373437IPR009057Homeodomain-like
PfamPF059202.6E-18387426IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MFLLNSVASG NFPHVSLPLQ AHAQGHLVGV PLPGDFQDSN RPSIQEISAS HHGLLSRLWT  60
SGDQSTPRGG GGGGEGNGSK SHIPSSTVVS PNSGSVGGTT TDFASQLGFQ RPGLVSPTQA  120
HHQGLSLSLS PQQQMNFGSS LPLDHREIST TNHQVGILSS SPGVNTSNID HTRGSGALSS  180
FSISNGMILG SKYLKVAQDL LDEVVSVGKN IKLSEVGGAK EKHKLENELI SLASDDIESN  240
TQKNSGVELT TAQRQELQMK KAKLVSMLDE VDQRYRQYHH QMQMIATSFE QTTGIGSSKS  300
YTQLALHTIS KQFRCLKDAI SGQIKDTNKT LGEEENIGGK IEGSKLKFVD HHLRQQRALQ  360
QLGMMQTNAW RPQRGLPERA VSVLRAWLFE HFLHPYPKDS DKIMLAKQTG LTRSQVSNWF  420
INARVRLWKP MVEEMYMEEV KKNNQEQNGL DQKIIEPNNN EIVGSKSSAP QEKLPISSNI  480
IHDATSNDIS TSTISTSPTG GGGSMPAQTV GGFSLIRSLN MDNIDDQRNN KKARNEMQSS  540
TIISMEREIM NKVKSENFNN TQTRECYTLM TPSYTMDDDQ QFGTRFNNQN HEQLATTFHQ  600
GSNGHVSLTL GLPPNSENQH NYIGLESHYN QPTHHPNISY ENIDFQSGKR YATQLLQDYV  660
S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B3e-16376434563Homeobox protein Meis2
3k2a_A3e-16376434563Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4066980.0AF406698.1 Solanum tuberosum BEL1-related homeotic protein 11 (Bel11) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010313381.10.0PREDICTED: BEL1-like homeodomain protein 1
TrEMBLK4DA520.0K4DA52_SOLLC; Uncharacterized protein
STRINGSolyc11g068950.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-91BEL1-like homeodomain 1